PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g098700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family LFY
Protein Properties Length: 426aa    MW: 46975.7 Da    PI: 6.7334
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g098700.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY608.71.2e-18513931386
         FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslse 95 
                     mdpe f++ +f+w+p  a++++p+ + + ++++++p   ++aa  ++l +le lf ayG+r++t+akiaelGft+stLv+mkdeel+++m+sls+
  Csa11g098700.1   1 MDPEGFTSGIFRWNPTRAMVPAPSPVPPLQQQPPTP---QTAAFGMRLGGLEGLFGAYGIRFYTAAKIAELGFTASTLVGMKDEELEEMMNSLSH 92 
                     9*************9999989998887766655555...6667778899********************************************** PP

         FLO_LFY  96 ifrldllvGeryGikaavraerrrlee..eeaekkrrkll...sedeet..aldalsqe....glseepvqeekeaagsggeglgeaelvaaeek 179
                     ifr++llvGeryGikaavraerrrl+e  ee++++rr+ll     d+ t  aldalsqe    glseepvq++ ++ ++g++g g +e+ + + k
  Csa11g098700.1  93 IFRWELLVGERYGIKAAVRAERRRLQEeeEEESSRRRHLLlsaPGDSGThlALDALSQEddwtGLSEEPVQQQDQTDAAGNNG-GYWEAGQGKMK 186
                     *************************995444567788877787444444459******988889******9977766665555.67777665533 PP

         FLO_LFY 180 kseeekkkaskkkqkrkkkkelkseededeeeeededeeg........sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqv 266
                     k + +++++       k +   + e+d+d +e ed+++++        sg  g+erqrehPfivtepgevargkknGLDYLf+LyeqCrefLlqv
  Csa11g098700.1 187 KLQPQRRRK-------KPMVA-SVETDDDGNEGEDDEGMDngnggvggSGGLGTERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLLQV 273
                     332222222.......22222.22223332222222222222333333666677***************************************** PP

         FLO_LFY 267 qkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfna 361
                     q+iak+rGekcPtkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvG+wrqacykplv+ia r+gwdidavfna
  Csa11g098700.1 274 QTIAKDRGEKCPTKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGSWRQACYKPLVNIACRHGWDIDAVFNA 368
                     *********************************************************************************************** PP

         FLO_LFY 362 hprLsiWYvPtkLrqLChlerskas 386
                     hprLsiWYvPtkLrqLChler++a+
  Csa11g098700.1 369 HPRLSIWYVPTKLRQLCHLERNNAA 393
                     **********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.1E-1951393IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MDPEGFTSGI FRWNPTRAMV PAPSPVPPLQ QQPPTPQTAA FGMRLGGLEG LFGAYGIRFY  60
TAAKIAELGF TASTLVGMKD EELEEMMNSL SHIFRWELLV GERYGIKAAV RAERRRLQEE  120
EEEESSRRRH LLLSAPGDSG THLALDALSQ EDDWTGLSEE PVQQQDQTDA AGNNGGYWEA  180
GQGKMKKLQP QRRRKKPMVA SVETDDDGNE GEDDEGMDNG NGGVGGSGGL GTERQREHPF  240
IVTEPGEVAR GKKNGLDYLF HLYEQCREFL LQVQTIAKDR GEKCPTKVTN QVFRYAKKSG  300
ASYINKPKMR HYVHCYALHC LDEEASNALR RAFKERGENV GSWRQACYKP LVNIACRHGW  360
DIDAVFNAHP RLSIWYVPTK LRQLCHLERN NAAAAAAAAA LVGGISCTGS STSGRGGCGG  420
DELRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1372304251194PROTEIN LEAFY
2vy2_A1e-1372304251194PROTEIN LEAFY
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4719320.0DQ471932.1 Brassica juncea cultivar Varuna LEAFY transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010444020.10.0PREDICTED: protein LEAFY-like isoform X1
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLQ6XPU80.0Q6XPU8_IONAC; LEAFY-like protein
STRINGAT5G61850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)